Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella typhimurium UPF0056 inner membrane protein marC(marC)

Recombinant Salmonella typhimurium UPF0056 inner membrane protein marC(marC)

SKU:CSB-CF358246SXB

Regular price £1,321.00 GBP
Regular price Sale price £1,321.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Uniprot NO.:P0A2L5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSYMASVYVFAIMMVAYY AGQLVMNTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAHESPEAKSKSEELADEPTANIA FVPLAMPSTAGPGTIAMIISSASTVRHGGEFPDWVIMVAPPIIFLAVAVILWGCLRSSGA IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGVLEIIKTYH

Protein Names:Recommended name: UPF0056 inner membrane protein marC

Gene Names:Name:marC Ordered Locus Names:STM1521

Expression Region:1-221

Sequence Info:full length protein

View full details