Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella typhi DNA-binding protein HU-beta(hupB)

Recombinant Salmonella typhi DNA-binding protein HU-beta(hupB)

SKU:CSB-EP363134SWW

Regular price £799.00 GBP
Regular price Sale price £799.00 GBP
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: hupB

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Salmonella typhi

Delivery time: 3-7 business days

Uniprot ID: P0A1R9

AA Sequence: MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-90aa

Protein length: Full Length

MW: 29.2 kDa

Alternative Name(s): HU-1 NS1

Relevance: Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.

Reference: "Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18." Deng W., Liou S.-R., Plunkett G. III, Mayhew G.F., Rose D.J., Burland V., Kodoyianni V., Schwartz D.C., Blattner F.R. J. Bacteriol. 185:2330-2337(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details