Recombinant Salmonella enterica OmpA family protein(A673_03341),partial

Recombinant Salmonella enterica OmpA family protein(A673_03341),partial

CSB-MP028238SBG
Regular price
£435.00 GBP
Sale price
£435.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: A673_03341

Biologically active: Not Tested

Expression system: Mammalian cell

Species of origin: Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958

Delivery time: 3-7 business days

Uniprot ID: S4JJH7

AA Sequence: DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 82-220aa

Protein length: Partial

MW: 18.6 kDa

Alternative Name(s):

Relevance:

Reference: McClelland M., Porwollik S., Desai P., Cheng P., Wollam A., Pepin K., Palsikar V.B., Fulton L., Fulton R., Delehaunty K., Fronick C., Godfrey J., Waligorski J., Appelbaum E., Tomlinson C., Warren W., Sodergren E., Weinstock G., Wilson R.K.Submitted (APR-2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share