Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella dublin Protein psiE(psiE)

Recombinant Salmonella dublin Protein psiE(psiE)

SKU:CSB-CF471000SWN

Regular price £1,212.00 GBP
Regular price Sale price £1,212.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella dublin (strain CT_02021853)

Uniprot NO.:B5FQQ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMPLSRSRLEFIATILQNVLNLGLLTLGLILVVFLGKETVHLADALFAPEQASKYELVEG LVIYFLYFEFIALIVKYFKSGLHFPLRYFVYIGITAIVRLIIVDHKTPMDVLLYSAAILL LVITLWLCNSNRLRRE

Protein Names:Recommended name: Protein psiE

Gene Names:Name:psiE Ordered Locus Names:SeD_A4620

Expression Region:1-136

Sequence Info:full length protein

View full details