Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella choleraesuis Electron transport complex protein RnfA(rnfA)

Recombinant Salmonella choleraesuis Electron transport complex protein RnfA(rnfA)

SKU:CSB-CF682195SBF

Regular price £1,278.00 GBP
Regular price Sale price £1,278.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella choleraesuis (strain SC-B67)

Uniprot NO.:Q57PH8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Protein Names:Recommended name: Electron transport complex protein RnfA

Gene Names:Name:rnfA Ordered Locus Names:SCH_1477

Expression Region:1-193

Sequence Info:full length protein

View full details