Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella arizonae Universal stress protein B(uspB)

Recombinant Salmonella arizonae Universal stress protein B(uspB)

SKU:CSB-CF431270STE

Regular price £1,213.00 GBP
Regular price Sale price £1,213.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Uniprot NO.:A9MM62

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQM RLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH

Protein Names:Recommended name: Universal stress protein B

Gene Names:Name:uspB Ordered Locus Names:SARI_04048

Expression Region:1-111

Sequence Info:full length protein

View full details