Gene Bio Systems
Recombinant Salmonella agona Protein AaeX(aaeX)
Recombinant Salmonella agona Protein AaeX(aaeX)
SKU:CSB-CF473227SWK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella agona (strain SL483)
Uniprot NO.:B5F7M6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV
Protein Names:Recommended name: Protein AaeX
Gene Names:Name:aaeX Ordered Locus Names:SeAg_B3557
Expression Region:1-67
Sequence Info:full length protein
