Gene Bio Systems
Recombinant Saimiriine herpesvirus 2 Transforming protein STP(1)
Recombinant Saimiriine herpesvirus 2 Transforming protein STP(1)
SKU:CSB-CF322432SAX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saimiriine herpesvirus 2 (strain 11) (SaHV-2) (Herpesvirus saimiri)
Uniprot NO.:P18347
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MARGLGEGDPQENDESNGDPPHNTDERSDGDDGPTPYLPVTLLNAGPFGPYNPYCLLGHP VQESGCPGRPTALSGAVGLPTPSGSRSSSHLSTPVGLSAVRVSGCGGAGSEEHVYAEVGS LHSEHEQEGDKCTDCSVTILLLLVIIVLLLIIIGLMLVIMFKKM
Protein Names:Recommended name: Transforming protein STP
Gene Names:Name:1 Synonyms:STP
Expression Region:1-164
Sequence Info:full length protein
