Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharophagus degradans UPF0059 membrane protein Sde_3288(Sde_3288)

Recombinant Saccharophagus degradans UPF0059 membrane protein Sde_3288(Sde_3288)

SKU:CSB-CF636424SAAX

Regular price £1,268.00 GBP
Regular price Sale price £1,268.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)

Uniprot NO.:Q21FI6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIDVVLLALALSMDAFAVSIGLGAKNKASPVVLGLKAALYFGVFQALMPLIGYLGGKGML GWLASFAPWVAAGLLALIAAKMIYESFAEGIEEDISQLTHRVLLLLAIATSIDALAAGFA LTVLPVAPLVSCALIGVITAIFSFAGVFIGKRAGTWLESKAELAGGLVLLLIALKIIAVA V

Protein Names:Recommended name: UPF0059 membrane protein Sde_3288

Gene Names:Ordered Locus Names:Sde_3288

Expression Region:1-181

Sequence Info:full length protein

View full details