Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit c(VMA3)

Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit c(VMA3)

SKU:CSB-CF328546SVG

Regular price £1,232.00 GBP
Regular price Sale price £1,232.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P25515

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTELCPVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMA GIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSS QQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVVC

Protein Names:Recommended name: V-type proton ATPase subunit c Short name= V-ATPase subunit c Alternative name(s): Guanine nucleotide exchange factor 2 V-ATPase 16 kDa proteolipid subunit 1 Vacuolar proton pump c subunit

Gene Names:Name:VMA3 Synonyms:CLS7, CUP5, GEF2 Ordered Locus Names:YEL027W

Expression Region:1-160

Sequence Info:full length protein

View full details