Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDH4)

Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDH4)

SKU:CSB-CF327656SVG

Regular price £1,228.00 GBP
Regular price Sale price £1,228.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P37298

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LTIPFLPVLPQKPGGVRGTPNDAYVPPPENKLEGSYHWYMEKIFALSVVPLATTAMLTTG PLSTAADSFFSVMLLGYCYMEFNSCITDYISERVYGVWHKYAMYMLGLGSAVSLFGIYKL ETENDGVVGLVKSLWDSSEKDNSQKIEAKK

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate-ubiquinone reductase membrane anchor subunit

Gene Names:Name:SDH4 Synonyms:ACN18 Ordered Locus Names:YDR178W ORF Names:YD9395.11

Expression Region:32-181

Sequence Info:full length protein

View full details