Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Inorganic phosphate transport protein PHO88(PHO88)

Recombinant Saccharomyces cerevisiae Inorganic phosphate transport protein PHO88(PHO88)

SKU:CSB-CF336427SVG

Regular price £1,261.00 GBP
Regular price Sale price £1,261.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P38264

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPQVSNIIIMLVMMQLSRRIDMEDPTIIMYIRILYCSSIGISWIIYQMARKRIVAKNDM TTMKYVEPGNAMSGEGEKLQVTTVRDYDLKEIDSAIKSIYTGMAMMGFMHLYLKYTNPLF MQSISPVKSALEHNEVKIHLFGKPATGDLKRPFKAPSLFGGMGQTGPKTDKKSIEEAERA GNAGVKAE

Protein Names:Recommended name: Inorganic phosphate transport protein PHO88 Alternative name(s): Phosphate metabolism protein PHO88

Gene Names:Name:PHO88 Ordered Locus Names:YBR106W ORF Names:YBR0835

Expression Region:1-188

Sequence Info:full length protein

View full details