Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Increased recombination centers protein 18(IRC18)

Recombinant Saccharomyces cerevisiae Increased recombination centers protein 18(IRC18)

SKU:CSB-CF342853SVG

Regular price £1,316.00 GBP
Regular price Sale price £1,316.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P47056

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKVQMIERIFLIQLCLLTVVLASSRAVVEFESTGTKLVNSLRVLAAYSQSSVCVDEKISG IERQIEEVKDMYGNHSFILKGLNGILNNKVNMLTREIQMETVGNNTFETETGKLTKGLNR AVNISPFKYIKKFKTVSTKKFESLLNKYDLVAKKGGELTEEQKKKKEVLSRISRVVAATT IEAGLAQGVVDLCITVTTSLCLVSASIGGVGFLIWLTIIYQALT

Protein Names:Recommended name: Increased recombination centers protein 18

Gene Names:Name:IRC18 Ordered Locus Names:YJL037W ORF Names:J1234

Expression Region:1-224

Sequence Info:full length protein

View full details