Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Golgi SNAP receptor complex member 1(GOS1)

Recombinant Saccharomyces cerevisiae Golgi SNAP receptor complex member 1(GOS1)

SKU:CSB-CF009677SVG

Regular price £1,309.00 GBP
Regular price Sale price £1,309.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P38736

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSQPSFVTIRGKAISLETQTESLLSKYSTFAQTTSSEQTGQEKKIDKQLEGILGQRQDVIDSLTQICDSNPAISASKLSQLHRHKEILQDHWKSFRNIRSSIQQERNRLNLLFSVKNDIANSTTDAPAPIGDADEYIQNETRRIDQSNNVVDRLISQAWETRSQFHSQSNVLNTANNKVLQTLQRIPGVNQLIMKINTRRKKNAFVLATITTLCILFLFFTW

Protein Names:Recommended name: Golgi SNAP receptor complex member 1 Alternative name(s): Golgi SNARE protein 1 Protein transport protein GOS1

Gene Names:Name:GOS1 Ordered Locus Names:YHL031C

Expression Region:2-223

Sequence Info:full length protein

View full details