Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP18(TVP18)

Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP18(TVP18)

SKU:CSB-CF312029SVG

Regular price £1,243.00 GBP
Regular price Sale price £1,243.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q04767

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML

Protein Names:Recommended name: Golgi apparatus membrane protein TVP18 Alternative name(s): TLG2 compartment vesicle protein of 18 kDa

Gene Names:Name:TVP18 Ordered Locus Names:YMR071C ORF Names:YM9916.10C

Expression Region:1-167

Sequence Info:full length protein

View full details