Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Dolichol-phosphate mannosyltransferase(DPM1)

Recombinant Saccharomyces cerevisiae Dolichol-phosphate mannosyltransferase(DPM1)

SKU:CSB-CF007134SVG

Regular price £1,350.00 GBP
Regular price Sale price £1,350.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P14020

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF

Protein Names:Recommended name: Dolichol-phosphate mannosyltransferase EC= 2.4.1.83 Alternative name(s): Dolichol-phosphate mannose synthase Short name= DPM synthase Dolichyl-phosphate beta-D-mannosyltransferase Mannose-P-dolichol synthase Short name= MPD synthase

Gene Names:Name:DPM1 Synonyms:SED3 Ordered Locus Names:YPR183W ORF Names:P9705.3

Expression Region:2-267

Sequence Info:full length protein

View full details