Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Cytochrome b-c1 complex subunit 10(QCR10)

Recombinant Saccharomyces cerevisiae Cytochrome b-c1 complex subunit 10(QCR10)

SKU:CSB-CF025663SVG

Regular price £1,159.00 GBP
Regular price Sale price £1,159.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P37299

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AYTSHLSSKTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPL LGPTLEDHTPPEDKPN

Protein Names:Recommended name: Cytochrome b-c1 complex subunit 10 Alternative name(s): Complex III subunit 10 Complex III subunit XI Ubiquinol-cytochrome c reductase complex 8.5 kDa protein

Gene Names:Name:QCR10 Ordered Locus Names:YHR001W-A ORF Names:YHR001BW

Expression Region:2-77

Sequence Info:full length protein

View full details