Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Chitobiosyldiphosphodolichol beta-mannosyltransferase(ALG1)

Recombinant Saccharomyces cerevisiae Chitobiosyldiphosphodolichol beta-mannosyltransferase(ALG1)

SKU:CSB-CF001593SVG

Regular price £1,511.00 GBP
Regular price Sale price £1,511.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P16661

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFLEIPRWLLALIILYLSIPLVVYYVIPYLFYGNKSTKKRIIIFVLGDVGHSPRICYHAISFSKLGWQVELCGYVEDTLPKIISSDPNITVHHMSNLKRKGGGTSVIFMVKKVLFQVLSIFKLLWELRGSDYILVQNPPSIPILPIAVLYKLTGCKLIIDWHNLAYSILQLKFKGNFYHPLVLISYMVEMIFSKFADYNLTVTEAMRKYLIQSFHLNPKRCAVLYDRPASQFQPLAGDISRQKALTTKAFIKNYIRDDFDTEKGDKIIVTSTSFTPDEDIGILLGALKIYENSYVKFDSSLPKILCFITGKGPLKEKYMKQVEEYDWKRCQIEFVWLSAEDYPKLLQLCDYGVSLHTSSSGLDLPMKILDMFGSGLPVIAMNYPVLDELVQHNVNGLKFVDRRELHESLIFAMKDADLYQKLKKNVTQEAENRWQSNWERTMRDLKLIH

Protein Names:Recommended name: Chitobiosyldiphosphodolichol beta-mannosyltransferase EC= 2.4.1.142 Alternative name(s): Asparagine-linked glycosylation protein 1 Beta-1,4-mannosyltransferase GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase GDP-mannose-dolichol diphosphochitobiose mannosyltransferase

Gene Names:Name:ALG1 Ordered Locus Names:YBR110W ORF Names:YBR0906

Expression Region:1-449

Sequence Info:full length protein

View full details