Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Chitin synthase 1(CHS1),partial

Recombinant Saccharomyces cerevisiae Chitin synthase 1(CHS1),partial

SKU:CSB-RP162774Ba(N)

Regular price £798.00 GBP
Regular price Sale price £798.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P08004

Gene Names: CHS1

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: QNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTSPSIASSSDGYADQEARPILE

Expression Region: 4-200aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 26.6 kDa

Alternative Name(s): Chitin-UDP acetyl-glucosaminyl transferase 1

Relevance: Septum formation and repair, especially under certain adverse conditions.

Reference: The S. cerevisiae structural gene for chitin synthase is not required for chitin synthesis in vivo.Bulawa C.E., Slater M., Cabib E., Au-Young J., Sburlati A., Adair W.L. Jr., Robbins P.W.Cell 46:213-225(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details