Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia peacockii Probable intracellular septation protein A (RPR_05830)

Recombinant Rickettsia peacockii Probable intracellular septation protein A (RPR_05830)

SKU:CSB-CF504156RMX

Regular price £1,268.00 GBP
Regular price Sale price £1,268.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rickettsia peacockii (strain Rustic)

Uniprot NO.:C4K2C9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKLLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:RPR_05830

Expression Region:1-180

Sequence Info:full length protein

View full details