Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia japonica 17 kDa surface antigen(omp)

Recombinant Rickettsia japonica 17 kDa surface antigen(omp)

SKU:CSB-EP706583RMU

Regular price £891.00 GBP
Regular price Sale price £891.00 GBP
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: omp

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Rickettsia japonica (strain ATCC VR-1363 / YH)

Delivery time: 3-7 business days

Uniprot ID: Q52764

AA Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-159aa

Protein length: Full Length

MW: 30.5 kDa

Alternative Name(s):

Relevance:

Reference: "Specific amplification of Rickettsia japonica DNA from clinical specimens by PCR."Furuya Y., Katayama T., Yoshida Y., Kaiho I.J. Clin. Microbiol. 33:487-489(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details