Skip to product information
1 of 1

GeneBio Systems

Recombinant Ricinus communis Ricin, partial

Recombinant Ricinus communis Ricin, partial

SKU:P02879

Regular price £902.00 GBP
Regular price Sale price £902.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Epigenetics and Nuclear Signaling

Uniprot ID: P02879

Gene Names: N/A

Alternative Name(s): rRNA N-glycosidase

Abbreviation: Recombinant Ricinus communis Ricin protein, partial

Organism: Ricinus communis (Castor bean)

Source: E.coli

Expression Region: 36-302aa

Protein Length: Partial

Tag Info: Tag-Free

Target Protein Sequence: IFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRCAPPPSSQF

MW: 30.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Ricin is highly toxic to animal cells, and to a lesser extent to plant cells.; [Ricin A chain]: Acts as a glycosidase that removes a specific adenine residue from an exposed loop of the 28S rRNA A4324 in mammals, leading to rRNA breakage. As this loop is involved in elongation factor binding, modified ribosomes are catalytically inactive and unable to support protein synthesis. Can inactivate a few thousand ribosomes per minute, faster than the cell can make new ones. Therefore a single molecule can kill an animal cell.; [Ricin B chain]: Binds to beta-D-galactopyranoside moieties on cell surface glycoproteins and glycolipids and facilitates the entry into the cell of the A chain. Also responsible for cell agglutination Lectin activity.

Reference:

Function:

View full details