Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ricinus communis Casparian strip membrane protein RCOM_1259260 (RCOM_1259260)

Recombinant Ricinus communis Casparian strip membrane protein RCOM_1259260 (RCOM_1259260)

SKU:CSB-CF495607RMM

Regular price £1,272.00 GBP
Regular price Sale price £1,272.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ricinus communis (Castor bean)

Uniprot NO.:B9SX13

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMKSDSVAIDVPESSSVAKRKAPFMANIRDENGGYKKGLAIFDFILRLGAIAAALGAAST MGTSDETLPFFTQFFQFNAGYDDFPTFQFFVIAMAMVAGYLVLSLPFSIVSICRPHAAGP RILLFILDTVALTLNAAAGAAAADIVYLAHNGNQTTNWLAICLQFGDFCREVSGSVVASF ASVVILMVLVVMSGLALRRY

Protein Names:Recommended name: Casparian strip membrane protein RCOM_1259260

Gene Names:ORF Names:RCOM_1259260

Expression Region:1-200

Sequence Info:full length protein

View full details