Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodospirillum centenum UPF0060 membrane protein RC1_3291 (RC1_3291)

Recombinant Rhodospirillum centenum UPF0060 membrane protein RC1_3291 (RC1_3291)

SKU:CSB-CF469491RLY

Regular price £1,192.00 GBP
Regular price Sale price £1,192.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodospirillum centenum (strain ATCC 51521 / SW)

Uniprot NO.:B6IWH9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATIATYLLAAVAEIGGCFAFWAWLRLDRSPLWLIPGMASLALFAWALTRIDSDLAGRAY AAYGGIYILTSLVWMWLVEGSRPDRWDTLGTVLCVSGALVIIFGPRGGQ

Protein Names:Recommended name: UPF0060 membrane protein RC1_3291

Gene Names:Ordered Locus Names:RC1_3291

Expression Region:1-109

Sequence Info:full length protein

View full details