Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodococcus sp. UPF0060 membrane protein RHA1_ro06609(RHA1_ro06609)

Recombinant Rhodococcus sp. UPF0060 membrane protein RHA1_ro06609(RHA1_ro06609)

SKU:CSB-CF610421RLO

Regular price £1,187.00 GBP
Regular price Sale price £1,187.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodococcus sp. (strain RHA1)

Uniprot NO.:Q0S254

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTVAKSVALFAVAALFEIGGAWLVWQGVREHRGWIWIGAGVAALGAYGFVATLQPDAHFG RILAAYGGVFVAGSLIWGMVADGFRPDRWDVSGALICLLGMAVIMYAPR

Protein Names:Recommended name: UPF0060 membrane protein RHA1_ro06609

Gene Names:Ordered Locus Names:RHA1_ro06609

Expression Region:1-109

Sequence Info:full length protein

View full details