Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter sphaeroides Nitric oxide reductase subunit C(norC)

Recombinant Rhodobacter sphaeroides Nitric oxide reductase subunit C(norC)

SKU:CSB-CF520888RLG

Regular price £1,220.00 GBP
Regular price Sale price £1,220.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

Uniprot NO.:O06844

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SEILTKSRARNVFYGGSLFFIAVFVGLTVQSHNYVVSTTPALTDEVILGKHVWERNSCIN CHTLHGEGAYFAPEVGNVMTRWGVLDDPDAAAEMLGGWMDAQPSGVEGRRQMPHFELTDE EKRGLSEFLRWADQMNTQSWPPNDAG

Protein Names:Recommended name: Nitric oxide reductase subunit C Alternative name(s): NOR small subunit Nitric oxide reductase cytochrome c subunit

Gene Names:Name:norC Ordered Locus Names:Rsph17025_0970

Expression Region:2-147

Sequence Info:full length protein

View full details