Gene Bio Systems
Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfA(rnfA)
Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfA(rnfA)
SKU:CSB-CF667002RLF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Uniprot NO.:Q3IXC6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGDFFFILLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVLTLAAGASWMVE ALILEPLDLTFLRILSLILVIAAIVQFIEVVMRKLAPGLHRALGIYLPLITTNCAVLGVA LLNIQEGHGLASSLLYGFGSASGFTLVLVIFAGMRERLAQLSVPGPFAGAPIAFISAGLL SMAFMGFAGLAPN
Protein Names:Recommended name: Electron transport complex protein RnfA Alternative name(s): Nitrogen fixation protein RnfA
Gene Names:Name:rnfA Ordered Locus Names:RHOS4_32400 ORF Names:RSP_3192
Expression Region:1-193
Sequence Info:full length protein
