Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter capsulatus Heme exporter protein B(helB)

Recombinant Rhodobacter capsulatus Heme exporter protein B(helB)

SKU:CSB-CF329955RLD

Regular price £1,302.00 GBP
Regular price Sale price £1,302.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

Uniprot NO.:P29960

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRALLSRDLRLAIRAGGGFGLGLAFFLIVVTLVPFGVGPQGEILARIASGILWLGALLAC LLSLDRIFALDFEDGSLDLLATAPIPMEAVVTIKALAHWITTGLPLVLAAPLFAVLLHLP APAYLWLEVSLLLGTPALSVLGTFGAALTVGLKRGGLLLPLLALPLYVPTLIFGAELVRR GAEGLAIEVPLAMLAGITAATVALVPFASAAAIRVNLR

Protein Names:Recommended name: Heme exporter protein B Alternative name(s): Cytochrome c-type biogenesis protein HelB

Gene Names:Name:helB Synonyms:ccmB Ordered Locus Names:RCAP_rcc01786

Expression Region:1-218

Sequence Info:full length protein

View full details