Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter capsulatus Electron transport complex protein RnfG(rnfG)

Recombinant Rhodobacter capsulatus Electron transport complex protein RnfG(rnfG)

SKU:CSB-CF308751RLC

Regular price £1,281.00 GBP
Regular price Sale price £1,281.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodobacter capsulatus (Rhodopseudomonas capsulata)

Uniprot NO.:P97054

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDTPPPEKPKLPWFKASPLAHGIMLAMFALVTAVLLAVANDSTSAPIAARGAEDLAASL EQVIPHDLHDNDLAAAMRPVSDAEEGTIKVYVATKAGAVTGLAYELSGPGYSGQIRVLLG IAPDGTLLGVRVLSHTETPGLGDKIEVAKDDWILGFAGKSLADPEPGHWKVKRDGGVFDQ FSGATITPRAVVKTIYRGLMFFDRNKAALTAPLPPKS

Protein Names:Recommended name: Electron transport complex protein RnfG Alternative name(s): Nitrogen fixation protein RnfG

Gene Names:Name:rnfG

Expression Region:1-217

Sequence Info:full length protein

View full details