Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium radiobacter Octopine transport system permease protein occQ(occQ)

Recombinant Rhizobium radiobacter Octopine transport system permease protein occQ(occQ)

SKU:CSB-CF363584RKV

Regular price £1,304.00 GBP
Regular price Sale price £1,304.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)

Uniprot NO.:P0A4N5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDYSQLMGFGPDGWGYDMLRATAMTMAVAFSGFTIGLVFGCLGAAASLSSSGALQAAASG YTTALRGIPDLLVIYLFYFGSSSVISNVASLFGSSGFVGASTFLIGALAIGVVSGAYQTQ VLRGAVLALNKGEIEAGRAYGMGALLLFRRIVLPQAARYALPGVGNVWQLVLKESALISV IGLVELMRQAQVGSGSTRQPFSFYLTAAALYLLITFVSGQVFRLAETRSMRGLQRGV

Protein Names:Recommended name: Octopine transport system permease protein occQ

Gene Names:Name:occQ

Expression Region:1-237

Sequence Info:full length protein

View full details