Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium meliloti Probable intracellular septation protein A(R03236)

Recombinant Rhizobium meliloti Probable intracellular septation protein A(R03236)

SKU:CSB-CF835832RKU

Regular price £1,298.00 GBP
Regular price Sale price £1,298.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Uniprot NO.:Q92L49

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTIEAAKPKTEVSPLLKLVLELGPLMVFFFANSRGEWLAGRFPALAELGGPIFIATGLF MAATAAALIASWIMTRTLPMMPLVSGIVVFVFGALTLWLQNDTFIKMKPTIVNTLFGAIL LGGLLFGKSLLGYVFHAAFKLDEEGWRKLTIRWGVFFLFLAVLNEVIWRSFSTDFWVAFK VWGTMPITILFTLAQMPLIMKHSLEQDSAE

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:R03236 ORF Names:SMc03853

Expression Region:1-210

Sequence Info:full length protein

View full details