Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium etli UPF0314 protein RHE_CH03951(RHE_CH03951)

Recombinant Rhizobium etli UPF0314 protein RHE_CH03951(RHE_CH03951)

SKU:CSB-CF646475RKK

Regular price £1,268.00 GBP
Regular price Sale price £1,268.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium etli (strain CFN 42 / ATCC 51251)

Uniprot NO.:Q2K390

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAADVEYRVRHQAFWFVACLAVLVAQIIAEYLMGRVPICACGYVKLWEGGVNTSGNSQH LSDWYTPSHIIHGFLFYGLGYLILRRKPLAARLLLALMIESGWELLENSPLIIDRYRTAT MALDYYGDSILNSAMDTVFMCLGFFFAARAPVALTVVIAIFFEIFTGYVIRDNLTLNVLM LIWPVEAIKVWQGGL

Protein Names:Recommended name: UPF0314 protein RHE_CH03951

Gene Names:Ordered Locus Names:RHE_CH03951

Expression Region:1-195

Sequence Info:full length protein

View full details