Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium etli ATP synthase subunit b-b'(atpG)

Recombinant Rhizobium etli ATP synthase subunit b-b'(atpG)

SKU:CSB-CF457353RKL

Regular price £1,161.00 GBP
Regular price Sale price £1,161.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium etli (strain CIAT 652)

Uniprot NO.:B3PRF8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTYASQLLW LVITFSVFYLLMQKVIAPRIGAILDQRHTRISQDLEEAGRLKAEADAAVQTYEGELAAAR AKSNAIGSAARDAAKAKAEEDRRAVEASLSEKIKAAEVRIADIKAKAFADVGTIAEETAA AVVEQLIGGTAAQADVAAAVAAAKKEA

Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b'

Gene Names:Name:atpG Synonyms:atpF1 Ordered Locus Names:RHECIAT_CH0000956

Expression Region:1-207

Sequence Info:full length protein

View full details