Gene Bio Systems
Recombinant Rhizobium etli ATP synthase subunit b-b'(atpG)
Recombinant Rhizobium etli ATP synthase subunit b-b'(atpG)
SKU:CSB-CF457353RKL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium etli (strain CIAT 652)
Uniprot NO.:B3PRF8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTYASQLLW LVITFSVFYLLMQKVIAPRIGAILDQRHTRISQDLEEAGRLKAEADAAVQTYEGELAAAR AKSNAIGSAARDAAKAKAEEDRRAVEASLSEKIKAAEVRIADIKAKAFADVGTIAEETAA AVVEQLIGGTAAQADVAAAVAAAKKEA
Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b'
Gene Names:Name:atpG Synonyms:atpF1 Ordered Locus Names:RHECIAT_CH0000956
Expression Region:1-207
Sequence Info:full length protein
