Gene Bio Systems
Recombinant Rat Vesicle transport protein SFT2B(Sft2d2)
Recombinant Rat Vesicle transport protein SFT2B(Sft2d2)
SKU:CSB-CF674572RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q4FZV2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDKLKKVLSGQDTEDRSGLSEVVESSSLSWSTRIKGFIVCFALGILCSLLGTLLLWVSRK GLFAVFYTLGNITSIGSTMFLMGPLKQLKRMFEPTRLIATILVLLFFVLTLCSAFLWNKG LALIFCILQSLALTWYSLSYIPYARDAVKKCFAVCLT
Protein Names:Recommended name: Vesicle transport protein SFT2B Alternative name(s): SFT2 domain-containing protein 2
Gene Names:Name:Sft2d2
Expression Region:1-157
Sequence Info:full length protein
