Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Type 2 lactosamine alpha-2,3-sialyltransferase(St3gal6)

Recombinant Rat Type 2 lactosamine alpha-2,3-sialyltransferase(St3gal6)

SKU:CSB-CF022756RA

Regular price £1,406.00 GBP
Regular price Sale price £1,406.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P61943

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKGYVVAIFLSSIFLYYVLYCILWGTNGYWFPNEEMKSKNNVKNCFKKPAFASLLRFPQFYPFLCKADFVKVAATYGTNNFLLPYGVKTFESYFRSGLSKLQSCDLVGQFDTVPCKRCVVVGNGGVLKNKTLGAKIDSYDVIIRMNNGPVLGHEEEVGKRTTFRLFYPESVFSDPSHYDPNTTAVLVVFKPQDLRWLMEILIGKKINTDGFWKKPALKLIYKQYQIRILDPYIIREAAFQLLRFPRVFPKDQKPKHPTTGIIALTLAFHICSEVHLAGFKYNFYTPDSPLHYYGNATMSLMKKNAYHNLTAEQLFLKNLIKKKMVINLTQN

Protein Names:Recommended name: Type 2 lactosamine alpha-2,3-sialyltransferase EC= 2.4.99.- Alternative name(s): CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI ST3Gal VI Short name= ST3GalVI Sialyltransferase 10

Gene Names:Name:St3gal6 Synonyms:Siat10

Expression Region:1-331

Sequence Info:full length protein

View full details