Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Trimeric intracellular cation channel type A(Tmem38a)

Recombinant Rat Trimeric intracellular cation channel type A(Tmem38a)

SKU:CSB-CF023832RA

Regular price £1,349.00 GBP
Regular price Sale price £1,349.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:A6ZIQ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLISSLSLGELALSFSRVPLFPVFDLSYFIVSIIYLKYEPGSVELSRRHPVASWLCAML HCFGSYILADLLLGEPIIDYFSNSSSILLASGVWYLIFFCPLDLFYKCVCFLPVKLIFVA MKEVVRVRKIAVGIHHAHHYHHGWFIMIATGWVKGSGVALLSNLEQLLRGVWKPETNEIL HMSFPTKASLYGAILFTLQQTRWLPVSKASLIFVFTMFMVSCKVFLTATHSHSSPFDVLE GYICPVLFGATWGGDHHHDNHGAPHGMGLGTQHSGLPAKAKEELSEGFRKKKTKKAD

Protein Names:Recommended name: Trimeric intracellular cation channel type A Short name= TRIC-A Short name= TRICA Alternative name(s): 27 kDa sarcoplasmic reticulum protein SPR-27 Transmembrane protein 38A

Gene Names:Name:Tmem38a

Expression Region:1-297

Sequence Info:full length protein

View full details