Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Transmembrane protein 170B(Tmem170b)

Recombinant Rat Transmembrane protein 170B(Tmem170b)

SKU:CSB-CF023752RA

Regular price £1,230.00 GBP
Regular price Sale price £1,230.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q7TQ79

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRAEGADHSMINLSVQQVLSLWAHGTVLRNLTEMWYWIFLWALFSSLFVHGAAGVLMFVM LQRHRQGRVLSIIAVSIGFLASVTGAMITSAAVAGIYRVAGKNMAPLEALVWGVGQTVLT LIISFSRILATL

Protein Names:Recommended name: Transmembrane protein 170B Alternative name(s): Liver regeneration-related protein LRRG102

Gene Names:Name:Tmem170b ORF Names:Ac1258

Expression Region:1-132

Sequence Info:full length protein

View full details