Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat T-cell surface glycoprotein CD8 alpha chain(Cd8a)

Recombinant Rat T-cell surface glycoprotein CD8 alpha chain(Cd8a)

SKU:CSB-CF004966RA

Regular price £1,300.00 GBP
Regular price Sale price £1,300.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P07725

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIYIWAPLAGICAVLLLSLVITLICCHRNRRRVCKCPRPLVKPRPSEKFV

Protein Names:Recommended name: T-cell surface glycoprotein CD8 alpha chain Alternative name(s): CD8 antigen 32 kDa chain OX-8 membrane antigen CD_antigen= CD8a

Gene Names:Name:Cd8a

Expression Region:27-236

Sequence Info:full length protein

View full details