Gene Bio Systems
Recombinant Rat Putative gustatory receptor clone PTE03(Olr1145)
Recombinant Rat Putative gustatory receptor clone PTE03(Olr1145)
SKU:CSB-CF339605RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P35895
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TTVPKMLINLQKQNKAISYAGCITQLSFVLLFAGMENFLLAAMAYDRYVAICKPLRYTAI MKAHLCLVMTLLSLCISIVDALLHGLMILRLSFCTFLEIPHYFCELYQVIKLSCSDTLIN NILVYTMTSTLGGVPLGGIIFSYFKIISSILRMPSSGSRHRAFSTCGS
Protein Names:Recommended name: Putative gustatory receptor clone PTE03
Gene Names:Name:Olr1145
Expression Region:1-168
Sequence Info:full length protein
