Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Protein cornichon homolog 3(Cnih3)

Recombinant Rat Protein cornichon homolog 3(Cnih3)

SKU:CSB-CF005650RA

Regular price £1,232.00 GBP
Regular price Sale price £1,232.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:D0Q0Y7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERI CFLLRKLVLPEYSIHSLFCVMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPP VVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS

Protein Names:Recommended name: Protein cornichon homolog 3

Gene Names:Name:Cnih3

Expression Region:1-160

Sequence Info:Full length protein

View full details