Gene Bio Systems
Recombinant Rat Proline-rich membrane anchor 1(Prima1)
Recombinant Rat Proline-rich membrane anchor 1(Prima1)
SKU:CSB-CF018682RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:D3ZZP4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EPQKSCSKVTDSCQHICQCRPPPPLPPPPPPPPPPRLLSAPAPNSTSCPAEDSWWSGLVIIVAVVCASLVFLTVLVIICYKAIKRKPLRKDENGASVAEYPMSSSPSNKGVDVNAAVV
Protein Names:Recommended name: Proline-rich membrane anchor 1 Short name= PRiMA
Gene Names:Name:Prima1
Expression Region:36-153
Sequence Info:full length protein
