Gene Bio Systems
Recombinant Rat Prolactin-inducible protein homolog(Pip)
Recombinant Rat Prolactin-inducible protein homolog(Pip)
SKU:CSB-YP530344RA
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: O70417
Gene Names: Pip
Organism: Rattus norvegicus (Rat)
AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN
Expression Region: 27-146aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 15.7 kDa
Alternative Name(s): Prolactin-induced protein
Relevance:
Reference: Expression of gross cystic disease fluid protein-15/Prolactin-inducible protein in rat salivary glands.Mirels L., Hand A.R., Branin H.J.J. Histochem. Cytochem. 46:1061-1071(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
