Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Proheparin-binding EGF-like growth factor(Hbegf)

Recombinant Rat Proheparin-binding EGF-like growth factor(Hbegf)

SKU:CSB-CF010154RA

Regular price £1,277.00 GBP
Regular price Sale price £1,277.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q06175

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQEVQDLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGMASSH

Protein Names:Recommended name: Proheparin-binding EGF-like growth factor Cleaved into the following chain: 1. Heparin-binding EGF-like growth factor Short name= 2. HB-EGF Short name= 3. HBEGF

Gene Names:Name:Hbegf Synonyms:Dtr, Hegfl

Expression Region:24-208

Sequence Info:full length protein

View full details