Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Phospholipase A2, membrane associated(Pla2g2a)

Recombinant Rat Phospholipase A2, membrane associated(Pla2g2a)

SKU:CSB-YP321246RA

Regular price £677.00 GBP
Regular price Sale price £677.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P14423

Gene Names: Pla2g2a

Organism: Rattus norvegicus (Rat)

AA Sequence: SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC

Expression Region: 22-146aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 16.1 kDa

Alternative Name(s): GIIC sPLA2Group IIA phospholipase A2;Phosphatidylcholine 2-acylhydrolase 2A

Relevance: Thought to participate in the regulation of the phospholipid metabolism in biombranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Reference: Structure of cDNA coding for rat platelet phospholipase A2.Komada M., Kudo I., Mizushima H., Kitamura N., Inoue K.J. Biochem. 106:545-547(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details