Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Peroxisomal membrane protein 4(Pxmp4)

Recombinant Rat Peroxisomal membrane protein 4(Pxmp4)

SKU:CSB-CF019111RA

Regular price £1,276.00 GBP
Regular price Sale price £1,276.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P59382

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AAPPQLRALLQAVNKLLRQRRYHAALAVIKGFRNGAVYGVKIRAPHALVMTFLFRSGSLQ EKLQAILKATYTHSRNLACFVFTYKSLQALQSHVQGGTHQMHSFLAAFIGGLLLFGENNN INSQINMYLTSRVLFALCRLGVEKGYIPALKWDPFPLHTAVIWGLVLWLFEYHRPTLQPS LQSSMTYLYEDSNVWHDLSDFLIFNKSRPSK

Protein Names:Recommended name: Peroxisomal membrane protein 4 Alternative name(s): 24 kDa peroxisomal intrinsic membrane protein

Gene Names:Name:Pxmp4 Synonyms:Pmp24

Expression Region:2-212

Sequence Info:Full length protein

View full details