Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Neuropilin and tolloid-like protein 2(Neto2)

Recombinant Rat Neuropilin and tolloid-like protein 2(Neto2)

SKU:CSB-CF015716RA

Regular price £1,555.00 GBP
Regular price Sale price £1,555.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:C6K2K4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IAVAQKTQDGQNIGIKHVPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIELTFDERYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGMKSPALIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSAIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCTSSTFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGVTSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLREKEISADLADLSEELDNYQKLRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQTHDCPEQALEDRVMEEIPCEIYVRGRDDSAQASISIDF

Protein Names:Recommended name: Neuropilin and tolloid-like protein 2 Alternative name(s): Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2

Gene Names:Name:Neto2 Synonyms:Btcl2

Expression Region:23-525

Sequence Info:full length protein

View full details