Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase(Pigl)

Recombinant Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase(Pigl)

SKU:CSB-CF017975RA

Regular price £1,338.00 GBP
Regular price Sale price £1,338.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O35790

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVVGLLCVAVAVLTWGFLRVWNSAERMRSPEQAGLPGAGSRALVVIAHPDDEAMFFAPTILGLARLKQQVSLLCFSSGNYYNQGEIRKKELLQSCAVLGIPPSRVMIIDKREFPDDPEVQWDTEHVASTILQHIHANATDLVVTFDAEGVSGHSNHIALYKAVRALHSGGKLPEGCSVLTLQSVNVLRKYVFLLDLPWTLLSPQGVLFVLTSKEVAQAKKAMSCHRSQLLWFRHLYTVFSRYMSVNSLQLL

Protein Names:Recommended name: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase EC= 3.5.1.89 Alternative name(s): Phosphatidylinositol-glycan biosynthesis class L protein Short name= PIG-L

Gene Names:Name:Pigl

Expression Region:1-252

Sequence Info:full length protein

View full details