Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Membrane magnesium transporter 1(Mmgt1)

Recombinant Rat Membrane magnesium transporter 1(Mmgt1)

SKU:CSB-CF014655RA

Regular price £1,189.00 GBP
Regular price Sale price £1,189.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:B5DF51

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDATNSSNLDALSSNTSLKLRKFDSLRR

Protein Names:Recommended name: Membrane magnesium transporter 1 Alternative name(s): Transmembrane protein 32

Gene Names:Name:Mmgt1 Synonyms:Tmem32

Expression Region:21-131

Sequence Info:full length protein

View full details