Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Interleukin-2 receptor subunit beta(Il2rb)

Recombinant Rat Interleukin-2 receptor subunit beta(Il2rb)

SKU:CSB-CF011650RA

Regular price £1,535.00 GBP
Regular price Sale price £1,535.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P26896

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCTFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPMAFRTRPADPKEIFPLPWLRCLLLVLGCFFGFLSCVCVLVKCRYLGPWLKTLLKCHIPDPSEFFSQLSSQHGGDLQKWLSSPVPQSFFSPTGSAPEISPLEVLDRDSKTMQMLLFQKEKASSPSPSGHSQASCFTNQGYFFFHLSNALEIESCQVYFTYDPCMEEDVEEDGPRLPEESPLPPLLPFTGEQDDYCAFPPRDDLLLFSPSMSTPNTAYGNSITPEERPPLSLQEGLPSLASPDLMGLQHPLELELGDDGEGMSTNSSGQQASVPEAALMGTTKTEARPVLTLNTDAYLSLQELQAQDSAHLI

Protein Names:Recommended name: Interleukin-2 receptor subunit beta Short name= IL-2 receptor subunit beta Short name= IL-2R subunit beta Short name= IL-2RB Alternative name(s): High affinity IL-2 receptor subunit beta p70-75 CD_antigen= CD122

Gene Names:Name:Il2rb

Expression Region:27-537

Sequence Info:full length protein

View full details