Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Interferon gamma(Ifng)

Recombinant Rat Interferon gamma(Ifng)

SKU:CSB-RP155744r-GB

Regular price £741.00 GBP
Regular price Sale price £741.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P01581

Gene Names: Ifng

Organism: Rattus norvegicus (Rat)

AA Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Expression Region: 23-156aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 42.5 kDa

Alternative Name(s):

Relevance: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Reference: Cloning and expression of the chromosomal immune interferon gene of the rat.Dijkema R., van der Meide P.H., Pouwels P.H., Caspers M., Dubbeld M., Schellekens H.EMBO J. 4:761-767(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details